PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0107s0038.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 471aa    MW: 50951.9 Da    PI: 7.1422
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0107s0038.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.74.8e-33203259259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          dDgynWrKYGqK+vkgs +prsYY+Ct a Cpvkkkvers  d++v+ei+Y+g+Hnh+
  Kalax.0107s0038.1.p 203 DDGYNWRKYGQKQVKGSAYPRSYYKCTNAACPVKKKVERSL-DGQVTEIIYKGQHNHK 259
                          8****************************************.***************7 PP

2WRKY106.61.3e-33357415159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK+vkg+++prsYY+Ct+++C+v+k+ver+a+dp++v++tYeg+Hnh+
  Kalax.0107s0038.1.p 357 LDDGYRWRKYGQKVVKGNPYPRSYYKCTTPECKVRKHVERAATDPRAVITTYEGKHNHD 415
                          59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.7E-29196261IPR003657WRKY domain
PROSITE profilePS5081124.306197261IPR003657WRKY domain
SuperFamilySSF1182901.44E-25199261IPR003657WRKY domain
SMARTSM007745.4E-36202260IPR003657WRKY domain
PfamPF031064.0E-25203259IPR003657WRKY domain
Gene3DG3DSA:2.20.25.808.6E-37343417IPR003657WRKY domain
SuperFamilySSF1182902.22E-29349417IPR003657WRKY domain
PROSITE profilePS5081137.367352417IPR003657WRKY domain
SMARTSM007742.1E-38357416IPR003657WRKY domain
PfamPF031067.9E-26358415IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MAAERKNGSN ENNFPTQPQQ GINGPRPTLS LPPRSSAESM FLTSAGFSPG PMTLVSSFFS  60
ETDPSSEFRS FSQLLAGGFD SQDVKIDGGG GGGSGNGFEF KQNQPSHLPP GLTVSRPQLF  120
TIPPGLSPST LLDSPTIFGY NQNGFGMAAG SSQPQQQMQH QLNMDYPAPM ARFPTGMAAA  180
PVIGSSSDYA HNEMCAVADK PADDGYNWRK YGQKQVKGSA YPRSYYKCTN AACPVKKKVE  240
RSLDGQVTEI IYKGQHNHKP PPASKRSREA GAIGLEAGLY AEVTNLEGGS VSRNNEHDSS  300
DSEDVGDGDA GADEVDEDEP EAKRRITEAR ASEASASHRT LTEPKIVVQT TSEVDLLDDG  360
YRWRKYGQKV VKGNPYPRSY YKCTTPECKV RKHVERAATD PRAVITTYEG KHNHDVPAAK  420
SSSHNTARPQ EPQQNGSAGN HQASSNRTDY QNSSRQRPGA FPRLKEEQTS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A9e-43203418878Probable WRKY transcription factor 4
1wj2_A9e-43203418878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010258724.11e-151PREDICTED: probable WRKY transcription factor 4
SwissprotQ9XI901e-143WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLA0A068TVV41e-151A0A068TVV4_COFCA; Uncharacterized protein
STRINGfgenesh2_kg.1__1511__AT1G13960.11e-141(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-112WRKY DNA-binding protein 4